Anti-PTGER4 / EP4 Antibody IHC-plus LS-B6947

$495.00

SKU:

LS-B6947

Product Description

Presentation: TBS, pH 7.4, 0.02% sodium azide, 0.5 mg/ml BSA, 50% glycerol.

Target Species: Human

Host Species: Rabbit

Specificity: Does not cross-react with EP1, EP3, or EP4 receptors. The EP2 receptor appears to be expressed at low levels in many tissues and cell types, potentially making detection by immunochemical techniques difficult.

Reactivity: Human

Usage: ICC, IHC-P (1:100), WB (1:200)

Synonyms: PTGER4, EP4, EP4 prostaglandin receptor, EP4R, PGE receptor EP4 subtype, Prostanoid EP4 receptor, Prostaglandin E receptor 4, PGE receptor, EP4 subtype, PGE2 receptor EP4 subtype

Concentration:

Volume: 1 ea

Immunogen: Human EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey (100%); Gibbon, Bovine (97%); Rabbit (93%); Marmoset (90%); Bat, Hamster, Elephant, Panda (87%); Horse (83%); Mouse, Rat (80%).