Loading... Please wait...
Image 1
  • Image 1

Anti-PGIS / PTGIS Antibody (aa299-329) IHC-plus LS-B1615

$495.00
SKU:
LS-B1615
Quantity:
Pin It

 

Product Description

  • Presentation: TBS, pH 7.4, 0.5% BSA, 0.02% sodium azide, 50% glycerol.

  • Target Species: Bovine

  • Host Species: Rabbit

  • Specificity: Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1,2,3

  • Reactivity: Bovine, Human

  • Usage: IHC-P (5 g/ml), IP, WB

  • Synonyms: PTGIS, CYP8A1, Prostaglandin I2 synthase, Prostacyclin synthase, PTGI, CYP8, PGIS

  • Concentration:

  • Volume: 1 ea

  • Immunogen: Bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT). Percent identity by BLAST analysis: Bovine (100%); Horse, Pig (87%); Gibbon, Monkey, Bat (83%); Human (80%).

    • Find Similar Products by Category

    Product Reviews

    This product hasn't received any reviews yet. Be the first to review this product!

    Write review

    our newsletter

    Recent Updates

    Click the button below to add the Anti-PGIS / PTGIS Antibody (aa299-329) IHC-plus LS-B1615 to your wish list.