Loading... Please wait...
Image 1
  • Image 1

Anti-Brain Natriuretic Peptide 32 Antibody IHC-plus LS-B7491

$495.00
SKU:
LS-B7491
Quantity:
Pin It

 

Product Description

  • Presentation: Lyophilized from PBS. No preservative added

  • Target Species: Human

  • Host Species: Rabbit

  • Specificity:

  • Reactivity: Human

  • Usage: DB, ELISA (1:40000), IHC-P (10 g/ml)

  • Synonyms:

  • Concentration:

  • Volume:

  • Immunogen: Synthetic peptide (Human BNP: NH2-CSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH) conjugated with KLH

    • Find Similar Products by Category

    Product Reviews

    This product hasn't received any reviews yet. Be the first to review this product!

    Write review

    our newsletter

    Recent Updates

    Click the button below to add the Anti-Brain Natriuretic Peptide 32 Antibody IHC-plus LS-B7491 to your wish list.