Loading... Please wait...
Image 1
  • Image 1

Anti-AIFM1 / AIF / PDCD8 Antibody IHC-plus LS-B7901

$495.00
SKU:
LS-B7901
Quantity:
Pin It

 

Product Description

  • Presentation: TBS containing 50% glycerol, 0.5 mg/ml BSA, and 0.02% sodium azide

  • Target Species: Human

  • Host Species: Rabbit

  • Specificity:

  • Reactivity: Mouse, Rat, Human

  • Usage: IHC-P (5 g/ml), WB

  • Synonyms: AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8

  • Concentration:

  • Volume: 100 µl

  • Immunogen: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA

    • Find Similar Products by Category

    Product Reviews

    This product hasn't received any reviews yet. Be the first to review this product!

    Write review

    our newsletter

    Recent Updates

    Click the button below to add the Anti-AIFM1 / AIF / PDCD8 Antibody IHC-plus LS-B7901 to your wish list.